Efficient Gene Transfection by Electroporation—In Vitro and In Silico Study of Pulse Parameters
نویسندگان
چکیده
Gene electrotransfer (GET) is a widely used method for nucleic acids’ delivery into cells. We explored, evaluated, and demonstrated the potential use of different pulse durations introducing plasmid DNA (pDNA) cells in vitro compared efficiency dynamics transgene expression after GET. performed experiments on cell suspensions 1306 fibroblasts C2C12 myoblasts with four ranges (nanosecond, high frequency bipolar (HF-BP), micro- millisecond). Six concentrations pDNA encoding green fluorescent protein were used. show that GET can be achieved nanosecond pulses low repetition rate (10 Hz). The GET’s depends concentration line. Time are comparable between millisecond, microsecond, HF-BP, but depend greatly Lastly, based data obtained effect model probability membrane contact during was developed. shows migration dominated by diffusion HF-BP electrophoresis millisecond pulses. Modeling results provide valuable guidance further interpretations various protocols.
منابع مشابه
the study of aaag repeat polymorphism in promoter of errg gene and its association with the risk of breast cancer in isfahan region
چکیده: سرطان پستان دومین عامل مرگ مرتبط با سرطان در خانم ها است. از آنجا که سرطان پستان یک تومور وابسته به هورمون است، می تواند توسط وضعیت هورمون های استروئیدی شامل استروژن و پروژسترون تنظیم شود. استروژن نقش مهمی در توسعه و پیشرفت سرطان پستان ایفا می کند و تاثیر خود را روی بیان ژن های هدف از طریق گیرنده های استروژن اعمال می کند. اما گروه دیگری از گیرنده های هسته ای به نام گیرنده های مرتبط به ا...
15 صفحه اولstudy of cohesive devices in the textbook of english for the students of apsychology by rastegarpour
this study investigates the cohesive devices used in the textbook of english for the students of psychology. the research questions and hypotheses in the present study are based on what frequency and distribution of grammatical and lexical cohesive devices are. then, to answer the questions all grammatical and lexical cohesive devices in reading comprehension passages from 6 units of 21units th...
a study of the fifth child and ben in the world by doris lessing in the light of julia kristevas psychoanalytic concepts
این مطالعه به بررسی عوامل روانشناختی کریستوادردو رمان دوربس لسینگ،فرزندبنجم و بن دردنیای واقعی می بردازد.موفقیت یا شکست کاراکترهادر تکمیل شکست تتیزی یه کمک بدر وهم از مهم ترین دغدغه محقق می باشد.به بررسی تحلیل روانشناختی تمامی کاراکترها خصوصا بن برداخته و به دنبال نشانه هایی از جامعه شیشه ای کریستوا می باشد.
15 صفحه اولtechnical and legal parameters for determination of river boundary,( case study haraz river)
چکیده با توسعه شهر نشینی و دخل و تصرف غیر مجاز در حریم رودخانه ها خسارات زیادی به رودخانه و محیط زیست اطراف آن وارده می شود. در حال حاضر بر اساس آئین نامه اصلاح شده بستر و حریم رودخانه ها، حریم کمی رودخانه که بلافاصله پس از بستر قرار می گیرد از 1 تا20 متر از منتهی الیه طرفین بستر رودخانه تعیین، که مقدار دقیق آن در هر بازه از رودخانه مشخص نیست. در کشورهای دیگر روشهای متفاوتی من جمله: درصد ریسک...
15 صفحه اولIn Vitro Efficient Transfection by CM18-Tat11 Hybrid Peptide: A New Tool for Gene-Delivery Applications
Cell penetrating peptides (CPPs) are actively researched as non-viral molecular carriers for the controlled delivery of nucleic acids into cells, but widespread application is severely hampered by their trapping into endosomes. Here we show that the recently introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of Cecropin-A, 2-12 of Melittin, and 47-5...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Applied sciences
سال: 2022
ISSN: ['2076-3417']
DOI: https://doi.org/10.3390/app12168237